SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030677 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030677
Domain Number 1 Region: 45-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.53e-18
Family Chaperone J-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030677   Gene: ENSMMUG00000023304   Transcript: ENSMMUT00000032785
Sequence length 153
Comment pep:known chromosome:MMUL_1:15:24441776:24476068:-1 gene:ENSMMUG00000023304 transcript:ENSMMUT00000032785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPLLTPGWAAGAAGRRSYVLLAPFLLTLLLVRPSGALVEGLYCGTRDCYEVLGVSRSA
GKAEIARAYRQLARRYHPDRYRPEPADEGPGRTPQSAEEAFLLVATAYETLKVSQAAAEL
QQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Download sequence
Identical sequences F7FB09
ENSMMUP00000030677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]