SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030706 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030706
Domain Number 1 Region: 235-337
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.07e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 87-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000576
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000134
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030706   Gene: ENSMMUG00000023326   Transcript: ENSMMUT00000032816
Sequence length 860
Comment pep:known_by_projection chromosome:MMUL_1:13:46465059:46504565:1 gene:ENSMMUG00000023326 transcript:ENSMMUT00000032816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHK
LLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTG
HSIFDFTHPCDHEEIRENLSLKNGILNCVYFLLAPTGWESASPLSTSIREIAHGLAMQEK
WIVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHS
MDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRM
LAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMA
MNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGK
AILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSCSTPNSPEDYYT
SLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEER
LLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFD
AGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPP
VSPPHISTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGG
STSHLMWKRMKNLRGGSCPLMPDKPLSANVPNGKFTQNPVRGLGHPLRHLPLPQPPSAVS
PGENSKSRFPAQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPV
LGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSMMUP00000030706 9544.ENSMMUP00000030706 ENSMMUP00000030706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]