SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030909 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030909
Domain Number 1 Region: 134-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-20
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 2 Region: 490-561
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 191-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-19
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 374-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 5 Region: 550-619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 249-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 431-501
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 670-738
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 608-665
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 10 Region: 75-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000792
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 11 Region: 306-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000107
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 12 Region: 729-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000792
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 13 Region: 12-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000025
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030909   Gene: ENSMMUG00000023475   Transcript: ENSMMUT00000033032
Sequence length 1004
Comment pep:known chromosome:MMUL_1:8:3000518:3097585:-1 gene:ENSMMUG00000023475 transcript:ENSMMUT00000033032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSTVKETAVPCPSIETQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLEGRRLAQCQAN
GTWNIGDERPGCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLAN
GLWSGTETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHK
WSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNMGYLLQGASRAQCRSNGQWS
SPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSVLYHCKKGFYLLGSSALTCMANG
LWDRSLPKCLAISCGHPGVPANAILTGELFTYGATVHYSCRGSQSLIGNDTRVCQEDSHW
SGALPHCTGNNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSPERTCLLNGS
WSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTW
TGTAPDCTIISCGDPGTLANGIQFGTDFTFNQTVSYQCNPGYLMEPVTSATIRCTKDGTW
NQSKPVCKAVLCPQPPPVQNGTVEGTDFHWGSSISYSCVDGYQLSHSAILSCEGRGVWKG
EVPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRICQADGMWSGIQ
PACIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSG
IQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTG
KSPVCKIPSDVFFVNSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEASQVELKLT
GVYKKEEAHLLLKAFQIKGPADIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIHGKDFG
KFKLERQDPLNPDQDSSNHYHGTSSGSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYN
GYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSMMUP00000030909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]