SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030914
Domain Number 1 Region: 752-867
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-34
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1796-1916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 589-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 1452-1558
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 5 Region: 31-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-31
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 6 Region: 1975-2081
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 1271-1392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 8 Region: 208-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1111-1214
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 10 Region: 931-1040
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 11 Region: 1619-1734
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-21
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 12 Region: 410-517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-21
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 13 Region: 1391-1455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 14 Region: 528-589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 698-766
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 16 Region: 1216-1286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 17 Region: 1565-1629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 873-933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000778
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 1741-1804
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 20 Region: 348-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 21 Region: 1915-1979
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000106
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 22 Region: 144-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000119
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 1046-1106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000027
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030914   Gene: ENSMMUG00000023475   Transcript: ENSMMUT00000033037
Sequence length 2108
Comment pep:known chromosome:MMUL_1:8:3183980:5031968:-1 gene:ENSMMUG00000023475 transcript:ENSMMUT00000033037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAWRRFQSLLLLLGLLVLCARLLTAAKGQNCGGLVQGPNGTIESPGFPHGYPNYANCTW
IIITGERNRIQLSFHTFALEEDFDILSVYDGQPQQGNLKVRLSGFQLPSSIVSTGSILTL
WFTTDFAVSAQGFKALYEVLPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGH
AILTCIVSPGNGASWDFPAPFCRAEGACGGTLRGTSSSISSPHFPSEYENNADCTWTILA
EPGDTIALVFTDFQLEEGYDFLEISGTEAPSIWLTGMNLPSPVISSKNWLRLHFTSDSNH
RRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHKNSVLSQGGVALVSDMCPDPGIPENGRR
AGSDFRVGANVQFSCEDNYVLQGSKSITCQRVTETLAAWNNLISMCARTCGSNLRGPSGV
ITSPNYPVQYEDNAHCVWVITTADPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVL
YVLTGSSVPDLIVSMSNQIMWSSVSSDFFLGKRGSFVFPFSEIEKGGCGDPGIPAYGKRT
GSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPN
YPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEV
PSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIPINGRRFGDRFLLGSSV
SFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYK
DSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLIS
TGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLDPGIPVNGHRHGSDFGIRSTVTFSC
DPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIHGKSGTVLSPGFPDFYPNSLNCTWT
IEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQ
LRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFHFGVGDSLTFSCFPGYRLEG
ATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAG
KGIHLRARSFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLRLILNSTSNHLWLEFNTNGS
DTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDTVVLYSCNPGYAMHGSNTLTCL
SGDRRVWDKPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLH
FIVFDTEMAHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGF
SIQFSTSIAATCNDPGMPQNGTRYGDSREAGDTITFQCDPGYQLQGQAKITCVQLNNRFF
WQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNME
PSYDFLHIYEGEDSNSPLIGSYQGAQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEK
PREACFDPGNIMNGTRIGTDFKLGSTITYQCDSGYKIVDPSSITCVIGADGKPSWDQVLP
SCNAPCGGQYMGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAE
LFDGTHAQARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDT
QCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQSVPNALAQWNDTIPSCV
VPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIH
DGGDVTAPRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPA
LPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRWNYPSPLCIATCGGTLN
TLGGVILSPGFPGSYPNNLDCTWRISLPVGYGAHIQFLNFSTEANHDFLEIQNGPYHTSP
MIGQFSGTDLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQESGNIGPAFPCDTPFQARC
QAEERTFN
Download sequence
Identical sequences ENSMMUP00000030914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]