SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030972 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030972
Domain Number 1 Region: 132-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000356
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000749
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030972   Gene: ENSMMUG00000023530   Transcript: ENSMMUT00000033100
Sequence length 436
Comment pep:known_by_projection chromosome:MMUL_1:19:57428891:57436377:-1 gene:ENSMMUG00000023530 transcript:ENSMMUT00000033100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEAAVPAGPRLLLPAVGPGHAGTYACLAANPRTSRRRRSLLNLTVADLPPGAPQCSVEGG
PGDRSLRFRCSWPGGVPAASLQFQGLPEGIRAGPVSSVLLAAVPAHPRLSGVPITCLARH
LVATRTCIVTPEAPREVLLHPLVAETRLGEAEVALEASGCPPPSRASWAREGRPLAPGGG
SRLRLSQDGRKLHIGNFSLDWDLGNYSVLCSGALGAGGDQITLIGPSISSWRLQRARDAA
VLTWDVERGALISSFEIQAWPDGPDLGRTSTYKDWVSLLILGPQERSAVVPLPPRNPGIW
TFRILPILGGQPGTPSQSRVYQAGPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCRF
RGKTPEKKKHPSTLVPVATPSEKKMHSVTPVEISWPLDLKVPLEDHSSTRAYQATDPSPV
VSVDESSKTVRTATQV
Download sequence
Identical sequences ENSMMUP00000030972 ENSMMUP00000030972 9544.ENSMMUP00000030972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]