SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031259 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031259
Domain Number 1 Region: 117-207
Classification Level Classification E-value
Superfamily Immunoglobulin 6.7e-27
Family C1 set domains (antibody constant domain-like) 0.00000956
Further Details:      
 
Domain Number 2 Region: 27-152
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.55e-25
Family MHC antigen-recognition domain 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031259   Gene: ENSMMUG00000023733   Transcript: ENSMMUT00000033401
Sequence length 256
Comment pep:known chromosome:MMUL_1:4:26081750:26088842:1 gene:ENSMMUG00000023733 transcript:ENSMMUT00000033401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGSSEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSGRTSSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKVPPLVKV
THHVTSSVTTLRCRALNYYPQNITMKWLKDRQSMDAKEVEPKDVLPNGDGTYQGWITLTV
PPGEEQRYTCQVEHPGLDQPLLAFWEPSPSRTLVIGVISGIAVFVIILFIGILFIILRKR
QTSRGVMGHYVLAERE
Download sequence
Identical sequences H9FTP1
ENSMMUP00000031259 XP_014991111.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]