SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031454 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031454
Domain Number 1 Region: 109-207
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-28
Family I set domains 0.00046
Further Details:      
 
Domain Number 2 Region: 877-975
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-26
Family I set domains 0.00052
Further Details:      
 
Domain Number 3 Region: 581-674
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-25
Family I set domains 0.0000334
Further Details:      
 
Domain Number 4 Region: 406-495
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-25
Family I set domains 0.00044
Further Details:      
 
Domain Number 5 Region: 977-1070
Classification Level Classification E-value
Superfamily Immunoglobulin 8.42e-25
Family I set domains 0.0000766
Further Details:      
 
Domain Number 6 Region: 10-106
Classification Level Classification E-value
Superfamily Immunoglobulin 5.97e-24
Family I set domains 0.00075
Further Details:      
 
Domain Number 7 Region: 778-874
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-24
Family I set domains 0.00065
Further Details:      
 
Domain Number 8 Region: 209-302
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-23
Family I set domains 0.0000481
Further Details:      
 
Domain Number 9 Region: 1072-1171
Classification Level Classification E-value
Superfamily Immunoglobulin 7.6e-23
Family I set domains 0.000012
Further Details:      
 
Domain Number 10 Region: 1174-1266
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-23
Family I set domains 0.00058
Further Details:      
 
Domain Number 11 Region: 304-403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.46e-22
Family I set domains 0.00001
Further Details:      
 
Domain Number 12 Region: 676-775
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-18
Family I set domains 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031454   Gene: ENSMMUG00000013289   Transcript: ENSMMUT00000038354
Sequence length 1267
Comment pep:novel chromosome:MMUL_1:19:60724553:60831878:1 gene:ENSMMUG00000013289 transcript:ENSMMUT00000038354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASFCVSVSKKPSLSVQPGPVVAPGDKLTLQCGSDASYDRFVLYKEGEREFLQRPGRQPQ
AGLSQANFTLGPVRVSHGGQYRCCGAHNLSSEWSAPSDPLDILISGQFYDTVSLSVQPGP
TVASGENVTLLCQSWGQFHTFLLTKEGAAHPPLRLRSEHQAQQHQAEFPMGPVTSAHAGT
YRCYSSLSSNPYLLSHPSDPLELVVSGTLPKPTLWAEPGSMISKGSPVTLRCQGSLQVQE
YRLYKGKKPASWVRRIQQELVKKGYFAIASIAWEHTGQYRCQYYSHSWWSELSDPLELVV
TGAYSKPTLSALPSPVVASGGNVTLRCGSQVAFDGFILCKEGEDEHPQRLNSHFHAYGWS
RAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAR
GESLTLQCGSDVGYDRFALYKEGEGSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSLSSNP
YLLSVPSDPLELVVSVPTSTWNLYFKKRIEIHLIILDIFHSTMVKFWIRVRCDILSLSEH
WGLNHPQSRAVGGDAMTPILTLLICLGLSLGPRTHVQAGTLPKPTLWAEPGSMISEGSPV
TLRCQGSLQVQEYRLYREKKPASWVRRIQQELVKKGYFAIASITWEHTGRYRCQYYSHSW
WSEPSDPLELVVTGAYSKPTLSALLSPVVASGWNVTLQCGSRVAFDNYILCKEGEDEHPQ
CLNSHFHPRGWSWAVFSVVPVSLSRRWSYRCYGYDSSFPYVWSLPSDLLELLVPGVSKKP
SLSVQPGPVVAPGESLTLQCGSDAGYDRFSLYKEGACDFLQRPGWQPQAGLSQANFLLGP
VSRSHGGQYRCYSAHNLSSQWSAPSDPLDILIAGQIPDRSFLSVQPGPTVASGENVTLLC
QSQGWMHTFLLTKEGAADPPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPH
LLTHPSEPLELVVSGILPKPTLWAEPGSMISEGSPVTLRCQGSLQVQDYCLYREKKPASW
VRQIRQELVKKGYFAIGFITWEHTGQYRCQYYNHSWWSEPSDPLELVVIGAYSKPTLSAL
PSPVVASGRNVTLQCDSQVAFDGFILCKEGEDEHPQRLNCQSHARGWSWAVFSVGPVSPS
HRWSYRCYGYISSDPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVARGDKLTLQCGSDA
GYDRFALYKEGEGDFLQRPGQQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSPEWSAP
SDPLDIL
Download sequence
Identical sequences ENSMMUP00000031454 9544.ENSMMUP00000031454 ENSMMUP00000031452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]