SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031455 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031455
Domain Number 1 Region: 322-420
Classification Level Classification E-value
Superfamily Immunoglobulin 4.97e-27
Family I set domains 0.00052
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-26
Family I set domains 0.0000334
Further Details:      
 
Domain Number 3 Region: 223-319
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-24
Family I set domains 0.00065
Further Details:      
 
Domain Number 4 Region: 121-220
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-19
Family I set domains 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031455   Gene: ENSMMUG00000013289   Transcript: ENSMMUT00000038355
Sequence length 649
Comment pep:novel chromosome:MMUL_1:19:60723605:60771636:1 gene:ENSMMUG00000013289 transcript:ENSMMUT00000038355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTVLICLGLSLGPRTHVQAGTLPKPTLWAEPGSMISEGSPVTLRCQGSLQVQEYRL
YREKKPASWVRRIQQELVKKGYFAIASITWEHTGRYRCQYYSHSWWSEPSDPLELVVTGA
YSKPTLSALLSPVVASGWNVTLQCGSRVAFDNYILCKEGEDEHPQCLNSHFHPRGWSWAV
FSVVPVSLSRRWSYRCYGYDSSFPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGES
LTLQCGSDAGYDRFSLYKEGACDFLQRPGWQPQAGLSQANFLLGPVSRSHGGQYRCYSAH
NLSSQWSAPSDPLDILIAGQIPDRSFLSVQPGPTVASGENVTLLCQSQGWMHTFLLTKEG
AADPPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPHLLTHPSEPLELVVSG
PSGGPSSPTTGPTSTCGPEDQPLTPTGSAPQSGLGRHLGVVTGVLVAFVLLLFLLLLFLV
LRYRRQGKRWTSAQRKADFQHPAGAVEPEPRDRGLQRRSSPAADTQEENLYAAVKDTQPE
DGVELDSQQRPHDEDPQAVTYARVKHSRPRREMASPPSPLSEEFLDTKDTQAEEDRQMDT
EAAASEDPQDVTYAQLQSLTLRREATEPPPSQERAPPVESSIYATLTIH
Download sequence
Identical sequences ENSMMUP00000031455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]