SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031460 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031460
Domain Number 1 Region: 321-418
Classification Level Classification E-value
Superfamily Immunoglobulin 6.65e-25
Family I set domains 0.00077
Further Details:      
 
Domain Number 2 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-23
Family I set domains 0.00019
Further Details:      
 
Domain Number 3 Region: 221-317
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-22
Family I set domains 0.0012
Further Details:      
 
Domain Number 4 Region: 120-218
Classification Level Classification E-value
Superfamily Immunoglobulin 5.81e-22
Family I set domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031460   Gene: ENSMMUG00000016574   Transcript: ENSMMUT00000038360
Sequence length 626
Comment pep:known_by_projection chromosome:MMUL_1:19:60369235:60375978:-1 gene:ENSMMUG00000016574 transcript:ENSMMUT00000038360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTLPVLMCLGLSLGPRTHVQAPPPKPTLWAEPGSVIIRGSPMTLWCQGPLETQEYRLD
QEGLPWTWGRQNPLEPGAKAKFHIRSAVYSTAGRYRCYFETPAGWSEPSDPLELVVTGFY
AEPTLLALPSPVVASGGNVTLQCDIRNGFLTFVLVEEEQKLPRTLYSQNLPKGPSQALFP
VGPVTPSSRWRFRCYYYYRKNPQAWSNPSDPLEILVPGVSRKPSLLAPQGPVVARGGSLT
LQCRSDVGYDRFALYQEGGHVLLQRPGQQPQAGLSQASFTLSPVSRSHGGQYRCYGGHNL
SPKWSAPSVPLDILIAGLLRDTPSVSVRPGPTVASGENVTLFCQSWHNIDTLFLTKEGAA
HPPLRLKSKYQSYTYQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPLELVVSGPS
GDPSPPPTGSTPTPGLGRHLGVVTGVSAAFLKLCVQGSWFEFSQARHSVHFCPAHFYRPA
GAAGPEPKDQVLQRRASPVADVQEEILNAAVKNTQPEDSVELDSRQSPHDEDPQAVTYAR
VKHSGPRREMASPPSPLSEEFLDTKDTQAEEDRQMDTEAAASEDPQDVTYAQLQSLTLRR
EATEPPPPQEGESPVEPRVFETLAIH
Download sequence
Identical sequences ENSMMUP00000031460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]