SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031586 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031586
Domain Number 1 Region: 333-447,567-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-67
Family Phosphate binding protein-like 0.000000106
Further Details:      
 
Domain Number 2 Region: 2-311
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-33
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031586   Gene: ENSMMUG00000017431   Transcript: ENSMMUT00000038487
Sequence length 760
Comment pep:known_by_projection chromosome:MMUL_1:19:48307631:48379365:-1 gene:ENSMMUG00000017431 transcript:ENSMMUT00000038487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPS
NEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTP
LLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDS
SNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGPALSAALMFDAVHVVVSAVREL
NRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKS
RQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNE
RFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFT
ITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVL
FLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVS
GVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNS
RYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGG
LLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGM
ENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEEVSV
Download sequence
Identical sequences ENSMMUP00000031586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]