SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031629 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000031629
Domain Number - Region: 135-257
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0262
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031629   Gene: ENSMMUG00000028771   Transcript: ENSMMUT00000038528
Sequence length 271
Comment pep:known_by_projection chromosome:MMUL_1:19:44634495:44638821:-1 gene:ENSMMUG00000028771 transcript:ENSMMUT00000038528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRGYGAQRAPGGLRYPAASATPQAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPV
TKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYIPAMAFIT
YVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFL
GYKYPPLPPMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILAEAAAEGVPVR
GARNQLRMYLTMAVAAAQPLLMYWLTFHLVR
Download sequence
Identical sequences ENSMMUP00000031629 ENSMMUP00000031629 9544.ENSMMUP00000031629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]