SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031672 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031672
Domain Number 1 Region: 85-353
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-86
Family Eukaryotic proteases 0.0000000079
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031672
Domain Number - Region: 45-105
Classification Level Classification E-value
Superfamily SRCR-like 0.00228
Family Hepsin, N-terminal domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031672   Gene: ENSMMUG00000004844   Transcript: ENSMMUT00000038575
Sequence length 369
Comment pep:known chromosome:MMUL_1:19:41532551:41558243:1 gene:ENSMMUG00000004844 transcript:ENSMMUT00000038575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLQHQGSRTQLRGDGLPQVLGALRGVRAGRGGGAGLTPALPRALTHSELDVRTAGAN
GTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGRDTSLG
RWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQL
GVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICT
VTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGD
SGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKVKVGPRW
EPGWGCLGL
Download sequence
Identical sequences ENSMMUP00000031672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]