SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031673 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031673
Domain Number 1 Region: 53-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-62
Family Eukaryotic proteases 0.0000000324
Further Details:      
 
Domain Number 2 Region: 5-57
Classification Level Classification E-value
Superfamily SRCR-like 0.000000196
Family Hepsin, N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031673   Gene: ENSMMUG00000004844   Transcript: ENSMMUT00000038576
Sequence length 259
Comment pep:known chromosome:MMUL_1:19:41532550:41558243:1 gene:ENSMMUG00000004844 transcript:ENSMMUT00000038576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKEVQVSSADARLMVFDKTEGTWRLLCSSRSNTRVAGLSCEEMGFLRRNRVLSRWRVF
AGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCL
PAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFC
AGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFRE
WIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences A0A2K5JWD8 A0A2K5MA30 A0A2K5WUW2 A0A2K5YAF7 A0A2K6CZS5 F6XEI3
ENSMMUP00000031673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]