SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031843 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031843
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.93e-33
Family VPS28 N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 125-203
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.02e-22
Family VPS28 C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031843   Gene: ENSMMUG00000020667   Transcript: ENSMMUT00000038762
Sequence length 233
Comment pep:novel chromosome:MMUL_1:8:147079194:147082220:-1 gene:ENSMMUG00000020667 transcript:ENSMMUT00000038762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISTIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWWVSLPARQSPCPETLPARQSPPPAVLLRAHPTCPVLHSQAADPERHVGIR
Download sequence
Identical sequences 9544.ENSMMUP00000031843 ENSMMUP00000031843 ENSMMUP00000031843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]