SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031857 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031857
Domain Number 1 Region: 344-370
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000769
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Domain Number 2 Region: 231-308
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000964
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031857   Gene: ENSMMUG00000007152   Transcript: ENSMMUT00000038777
Sequence length 382
Comment pep:known chromosome:MMUL_1:8:146713118:146718538:-1 gene:ENSMMUG00000007152 transcript:ENSMMUT00000038777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAGGAAAASDLGSAAVLLTVHAAVRLLGARPDAEAQLRRLQLSADPERPGRFRLELL
DAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATV
EGQNGSSSSSSPPALGPEACPVSLPSPPEVPTPEADLPRSPGNLMEREELAGNLARAIAG
GDEKGAAQAAAILAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASTASSAHVALQVH
PHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPRE
APATGPSPQRPQKMDGEVGRLFPSSLGLPPGPQPAASSLPSPLQPSWPCPSCTFINAPSR
PGCEMCSTQRPCTWDPLAAAST
Download sequence
Identical sequences F6X2J2
XP_015001744.1.72884 XP_015001745.1.72884 ENSMMUP00000031857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]