SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031917 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031917
Domain Number 1 Region: 201-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000158
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 155-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000556
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 167-195,543-700
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000906
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 4 Region: 67-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 26-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000553
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031917   Gene: ENSMMUG00000001220   Transcript: ENSMMUT00000038835
Sequence length 769
Comment pep:known_by_projection chromosome:MMUL_1:19:6787309:6826299:1 gene:ENSMMUG00000001220 transcript:ENSMMUT00000038835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTGCCVMHSWERHTGPTLKPTTKDNKCRDSTMCPSHATCTSTVDSYYCACKQGFRSSNG
QNHFKDPGVECKDINECLTGRVCPEHSDCVNSMGSYNCNCQVGFISRNSICKNIYHMTSP
RRRGPWLGCHFLVKHDSVFCKGKYDFVGSLTNLTPHPFYTDIDECTEMCLINSTCTNTPG
SYFCTCHPGFAPSNGQLNFTDQKVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF
RPDPESSQKDGNFSCQRVPFKCKEDVIPDNEQVQQCQDRTTVKPEYATVSFCAQMNNIFS
VLDNVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVETLTLAAFL
KPSANVTQTVRTDYLDIESKVINKECSEENVNLSLAAKGDKMKIRCSTIEESESTGTTGV
AFVSFVGVESVLNERFFQDHQAPLTTSKIKLKMNSRVVGGIMTGEKKDGFSDPVIYTLEN
IQPKQEFERPICVSWSTDVKGGRWTSFGCVILEASEIHTVCSCNRMANLAVIMASGELTM
DFSLYVISHVGMIISLVCLVLAIATFLLCQSIRNHITYLHLHLCVCLLLAQILFLAGIDK
TDNQTGCAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHICAFGY
GLPVLVVVISASVQSQGYGMHNRCWLNTETGFIWSFLGPVCTVIAVSKYDNSLAKCVLEE
EQGDLRDLEFPGTCAAERINSILLTWTLWILRQRLSSVNAEVSTLKDTR
Download sequence
Identical sequences ENSMMUP00000031917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]