SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032004 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032004
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000105
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032004   Gene: ENSMMUG00000017845   Transcript: ENSMMUT00000038920
Sequence length 846
Comment pep:known chromosome:MMUL_1:8:108743855:109211115:1 gene:ENSMMUG00000017845 transcript:ENSMMUT00000038920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSNLSWLKKKSQSVDINAPGFNPLAAAGKQTPQASKPPAPKTPIIEEEQNNAANTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKTTNPDVH
PKETTPSSTFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIM
FDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCHS
KKMTGSNTEEIDSRIRDAGNDSASTAPRSTEGSLSEDVFTESELSPIREELVSSDELQQD
KSSGASSESVQTVNQTEVESLTVKSESTGTPGHSRSDTEHSTNEVGTLCHKTDLNNLEMA
IKEGDQIADNFQGISGPKEDSTNIKGNSDQDFFLRENSLHQEESKKENMPCGETAEFKQK
QTVKGKQGKEQNRDSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEAKHKITSADGHI
ESSALLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTD
HLYAFFIQWSPEIYAEDTGEYAREPGFIVVKKIEESETIEDSSNQAAAREWEITTREDIN
SKQVAPVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTS
LKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFK
WTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDI
EIWAFE
Download sequence
Identical sequences ENSMMUP00000023463 ENSMMUP00000032004 9544.ENSMMUP00000032004 XP_015001346.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]