SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032009 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032009
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-31
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 240-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 431-469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 145-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 392-430
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 192-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 355-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032009   Gene: ENSMMUG00000022789   Transcript: ENSMMUT00000006300
Sequence length 840
Comment pep:known chromosome:MMUL_1:8:106995962:107087636:-1 gene:ENSMMUG00000022789 transcript:ENSMMUT00000006300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWSTKESPRWRSALLLLFFAGVYACGETPEQIRAPSGIITSPGWPSEYPAKINCSWF
IRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYRACGSTIPPPYISSQDHIWI
RFHSDDSVSRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEI
CAKEANPPTATAFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTC
GQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYD
GLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWE
IPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPCSRNGVCYPRSDRCNYQNHC
PNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVI
GSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIP
PVEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLA
LVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDTAGASGGVAAPLPQKV
PPTTAVEATVGACASSSTQSTRGGHADNGRDVTSVEPPSVSPARHQLTSALSRMTQGLRW
VRFTLGRSSSVSQNQSPLRQLDNGVSGREDDDDVEMLIPVSDGSSDFDVNDCSRPLLDLA
SDQGQGLRQPYSATNPGVRPSNRDGPCERCGIVHTAQIPETCLEVTLKNETSDDEALLLC
Download sequence
Identical sequences ENSMMUP00000032009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]