SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032058 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032058
Domain Number 1 Region: 451-643
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-42
Family cAMP-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 216-444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-27
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032058   Gene: ENSMMUG00000017889   Transcript: ENSMMUT00000038971
Sequence length 810
Comment pep:known_by_projection chromosome:MMUL_1:8:89153253:89311550:-1 gene:ENSMMUG00000017889 transcript:ENSMMUT00000038971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTKVNKVKPIGENNENEQSSHQNEQDSHPSNQSQQTTAQEQNKGEEKSLKTNSTPV
MSEEPHTNIQDKLSKKNSSGDLTTNPDSQTAAEPTGTVPEQKEMDPEKEGPNSPQNKSPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEEHYYRLLCFKVKKMPLTEYLKRLKLPSSIDSYTDRLYLLWLLIVSLAYNWNCWFIPLR
LVFPYQTPDNIHYWLIVDIICDIIYLYDMLFIQPRLQFIRGGDIIVDPNELRKNYRTSTK
FQLDVASIIPFDVCYLFFGFNPIFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGY
LLFILHINACVYYWASNYEGIGTTRWVYDGEGNKYLRCYYWAVRTLITIGGLPEPQTLFE
IVFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRV
RTWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKAIGCDTQMIYDML
LRLKSILYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLA
AGGGNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATP
PRKDLAFLFPPKEETPKLFKTLLGGKGKASLARLLKLKQEQAAQKKENSEGEEEGKENED
KQKENEDKGKENEDKQKENEDKDKGREPEEKPLDRPECTASPIAVEEETQSVRTVLPRGT
SRQSLIISMAPSAEGGEEVLTIEVKEKAKQ
Download sequence
Identical sequences ENSMMUP00000023519 9544.ENSMMUP00000032058 ENSMMUP00000032058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]