SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032184 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032184
Domain Number 1 Region: 10-116
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 298-400
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 407-523
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 4 Region: 156-203
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000955
Family Scavenger receptor cysteine-rich (SRCR) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032184   Gene: ENSMMUG00000016658   Transcript: ENSMMUT00000039099
Sequence length 744
Comment pep:known_by_projection chromosome:MMUL_1:8:23403125:23471521:-1 gene:ENSMMUG00000016658 transcript:ENSMMUT00000039099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQAPANVAKIQLRLAGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAK
SWTASSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGF
KFDNSLINQIENLNIQVEDIRIRAILSAYRKRTPVTEGYVEVKEGKTWKQICDKHWTAKN
SRVVCGMFGFPGERTYNTKVYKEIWKLQQPRQAVRSDQSPSSWCSPRVSSPAPCGGVMEH
AVGFQVQGPCRNELGPLCEAGLSSRSRAQSLLFCLVAEGIRIDRCKPRYVDSWSQQPLVR
LRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGP
IHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGR
VEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVYANKVVMS
GVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRP
MFMLQCAMEENCLSASAAQTNPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHR
HYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWD
MYRHDIDCQWIDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCH
IGGSFSEETEKKFEHFSGLLNNQL
Download sequence
Identical sequences ENSMMUP00000032184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]