SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032186 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032186
Domain Number 1 Region: 56-162
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 324-426
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 433-549
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 4 Region: 202-275
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000288
Family Scavenger receptor cysteine-rich (SRCR) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032186   Gene: ENSMMUG00000016658   Transcript: ENSMMUT00000039101
Sequence length 773
Comment pep:known_by_projection chromosome:MMUL_1:8:23402260:23471659:-1 gene:ENSMMUG00000016658 transcript:ENSMMUT00000039101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPPCSRLCSCLAVLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSAYRKRTPVTEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKKAIEPGRGRSWPLEVPCVQLERRLSALSLSFQIRSRHPLNTLENSHLTPSLV
TPSQLFLPVGAKSNLRCYKKEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSAS
VVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAG
VRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLG
LGFASNAFQETWYWHGDVYANKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGV
ACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTNPTTGYRRLLRFSS
QIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDT
ECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNFEVA
ESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
Download sequence
Identical sequences ENSMMUP00000013469 ENSMMUP00000032186 9544.ENSMMUP00000032186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]