SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032207 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032207
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000209
Family C-type lectin domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032207   Gene: ENSMMUG00000018327   Transcript: ENSMMUT00000039121
Sequence length 65
Comment pep:novel scaffold:MMUL_1:1099214399381:2327:3401:-1 gene:ENSMMUG00000018327 transcript:ENSMMUT00000039121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFLTAISPSTWTGVFRDSSHHPWVTINGLTFKHEIKDSDHAEYNCAMLHLDRLKSVQCGS
SKRYY
Download sequence
Identical sequences 9544.ENSMMUP00000032207 ENSMMUP00000032207 ENSMMUP00000032207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]