SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032218 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032218
Domain Number 1 Region: 312-416
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000032218
Domain Number - Region: 140-234
Classification Level Classification E-value
Superfamily STAT 0.00173
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032218   Gene: ENSMMUG00000002296   Transcript: ENSMMUT00000039133
Sequence length 417
Comment pep:known_by_projection chromosome:MMUL_1:8:15975445:16042368:-1 gene:ENSMMUG00000002296 transcript:ENSMMUT00000039133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPKNSPPLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSIGSTNADDIT
QSLTGKGNDSEAETRFQEVFMEHMSNMEKRIQHISDMEANLIDAEHFQNFSMTTDQRFND
ILLQLSTLFSSVQGHGNTIDEISKSLISLNTTLLDLQLNIEKLNGKIQEKTFKQQEEISK
LEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGP
PGPPGEKGDRGPTGESGPRGFPGPVGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQ
KGEKGSGNTLTSFKKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVICRSLGYP
GVQAVHKAAHFGQGTGPIWLNEVYCFGRESSIEECKIRQWGTRTCSHSEDAGVTCTL
Download sequence
Identical sequences 9544.ENSMMUP00000032218 ENSMMUP00000003072 ENSMMUP00000032218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]