SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032238 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032238
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1188-1308
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 844-950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 4 Region: 1361-1481
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-31
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 5 Region: 663-784
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-30
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 6 Region: 1532-1651
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 7 Region: 503-606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 8 Region: 323-432
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1-90
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-22
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1011-1126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-21
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 11 Region: 2009-2077
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 12 Region: 2365-2436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.67e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 2066-2135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2249-2317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 15 Region: 2425-2494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 2306-2376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2124-2194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2545-2613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 783-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000378
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1823-1891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 21 Region: 2483-2540
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 22 Region: 90-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 608-678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 24 Region: 2181-2243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 25 Region: 1951-2013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 957-1021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000082
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 265-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 1761-1834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 1479-1548
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000135
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 1133-1196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 31 Region: 1307-1371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 32 Region: 438-498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000391
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 33 Region: 1650-1712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 2604-2662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 35 Region: 1905-1961
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 36 Region: 1708-1762
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000419
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032238   Gene: ENSMMUG00000023475   Transcript: ENSMMUT00000039155
Sequence length 2879
Comment pep:known chromosome:MMUL_1:8:2997840:3451087:-1 gene:ENSMMUG00000023475 transcript:ENSMMUT00000039155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSG
HIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIPINGRRFGDRFLLGSSVSFHCDDGF
VKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLNCEWI
IEAKPGHSIKITFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLL
FTTDNSRSSIGFLIHYESVTLESDSCLDPGIPVNGHRHGSDFGIRSTVTFSCDPGYTLSD
DEPLVCERNHQWNHALPSCDALCGGYIHGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKG
VQMIFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFS
ISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFHFGVGDSLTFSCFPGYRLEGATKLTCLG
GGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRAR
SFQLFEGDTLKVYDGKDSSSRPLGTFTKNELLRLILNSTSNHLWLEFNTNGSDTDQGFQL
TYTSFDLVKCEDPGIPNYGYRIRDEGHFTDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWD
KPLPSCIAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTEM
AHDILKVWDGPVDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSI
AATCNDPGMPQNGTRYGDSREAGDTITFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTC
IAACGGNLTGPAGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLHI
YEGEDSNSPLIGSYQGAQAPERIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDP
GNIMNGTRIGTDFKLGSTITYQCDSGYKIVDPSSITCVIGADGKPSWDQVLPSCNAPCGG
QYMGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHAQ
ARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEP
RYGRRIGSEFSAGSIVRFECNPGYLLQGSTALHCQSVPNALAQWNDTIPSCVVPCSGNFT
QRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAP
RLGSFSGTTVPALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKI
GDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTVRRWNYPSPLCIATCGGTLNTLGGVILS
PGFPGSYPNNLDCTWRISLPVGYGAHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGT
DLPAALLSTTHETLIHFYSDHSQNRQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQ
SISFECYPGYILIGHPVLTCQHGINRNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYP
ILKDCIWLITVPPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYS
STNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCH
PGYTLVGTDTLTCKLSSQLQFEGSLPTCEGSSGQSPLLVVLSGNHTEQSNFTSRSNQLYL
RWSTDHATSKKGFKIRYAAPYCSLTHPLKNGGILNRTAGAVGSKVHYFCKPGYRMIGHSN
ATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYECHEGFKLEPS
QQATAVCQEDGLWSNKGKLPTCKPVPCPSIETQLSEHVIWRLVSGSLNEYGAQVLLSCSP
GYYLEGRRLAQCQANGTWNIGDERPGCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNT
GYTLVGSHVRECLANGLWSGTETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGF
RLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNMGYLL
QGASRAQCRSNGQWSSPLPTCRVVNCSDPGFVENAIRHGQQNFPESFEYGMSVLYHCKKG
FYLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAILTGELFTYGATVHYSCRGSQS
LIGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGH
QLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYK
TSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNQTVSYQCNPGYLME
PVTSATIRCTKDGTWNQSKPVCKAVLCPQPPPVQNGTVEGTDFHWGSSISYSCVDGYQLS
HSAILSCEGRGVWKGEVPQCLPVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGS
SRRICQADGMWSGIQPACIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQ
GSTTRTCLANLTWSGIQTECIPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAG
GSEHRTCKADMKWTGKSPVCKIPSDVFFVNSVWKGYYEYLGKRQPATLTVDWFNATSSKV
NATFSEASQVELKLTGVYKKEEAHLLLKAFQIKGPADIFVSKFENDNWGLDGYVSSGLER
GGFTFQGDIHGKDFGKFKLERQDPLNPDQDSSNHYHGTSSGSVAAAILVPFFALILSGFA
FYLYKHRTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSMMUP00000030908 ENSMMUP00000032238 9544.ENSMMUP00000032238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]