SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032305 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032305
Domain Number 1 Region: 122-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.93e-48
Family Tyrosine-dependent oxidoreductases 0.0032
Further Details:      
 
Domain Number 2 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.00000000000057
Family WW domain 0.001
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily WW domain 0.0000000000519
Family WW domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032305   Gene: ENSMMUG00000010610   Transcript: ENSMMUT00000039219
Sequence length 353
Comment pep:known_by_projection chromosome:MMUL_1:20:76267428:76610824:1 gene:ENSMMUG00000010610 transcript:ENSMMUT00000039219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQVFFVDHINKRTTYVDPRLAFTVDDNPTKPSTQQRYDGSTTAMEILQGR
DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAM
ALDLALLRSVQHFAEAFKAKNVPLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPSKNDYWAMLAYNRSKLCN
VLFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMV
Download sequence
Identical sequences 9544.ENSMMUP00000032305 ENSMMUP00000032305 ENSMMUP00000013907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]