SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032351 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032351
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-46
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 120-220
Classification Level Classification E-value
Superfamily E set domains 2.8e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032351   Gene: ENSMMUG00000021843   Transcript: ENSMMUT00000039265
Sequence length 589
Comment pep:known_by_projection chromosome:MMUL_1:20:66460495:66568192:1 gene:ENSMMUG00000021843 transcript:ENSMMUT00000039265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEVEGKIIREKCQGAH
IVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLP
VPHPAQTQRPSSDSGHSHDSVLSAQRSLVCSIPQTYASMVTSSHLPQLQCGDESASKEQH
MIPSPVVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLP
GLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHALPHLQSMGYHCSNTGQRSLSSPVA
DQISGQPSSQLQPVTYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQSMPYQSPSSGT
ASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDR
EPNFATIGLQDITLDDDQFISDLEHQPSGSAEKWPNHSVLSCPAPFWRI
Download sequence
Identical sequences ENSMMUP00000032351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]