SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032424 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032424
Domain Number 1 Region: 50-113
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000581
Family 28-residue LRR 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032424   Gene: ENSMMUG00000012207   Transcript: ENSMMUT00000039345
Sequence length 113
Comment pep:known_by_projection chromosome:MMUL_1:20:48933188:48943897:1 gene:ENSMMUG00000012207 transcript:ENSMMUT00000039345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFAVWAPLSVLPWPLCCGTSGSPWPCSWTTTLWVTLAWSSCCLALVSARLCSECYRALLF
RFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVML
Download sequence
Identical sequences ENSMMUP00000032424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]