SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032452 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032452
Domain Number 1 Region: 280-393
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-22
Family Canonical RBD 0.000081
Further Details:      
 
Domain Number 2 Region: 422-461
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000549
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032452   Gene: ENSMMUG00000019637   Transcript: ENSMMUT00000039375
Sequence length 532
Comment pep:known_by_projection chromosome:MMUL_1:20:29278096:29288962:1 gene:ENSMMUG00000019637 transcript:ENSMMUT00000039375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQSTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPTPSSTSGSYGSSSQTS
SYGQPPSGGYGQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSSGSGGGGSYGQDQSS
MSGGGGGGGGGGGGSSGGGGGGYGNQDQSGGGGSGYGQQDRGGRGRGGSSGGGGGGGGYN
RSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLG
ENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDW
FDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSG
GGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRR
GGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERP
Download sequence
Identical sequences ENSMMUP00000032452 9544.ENSMMUP00000032452 ENSMMUP00000025801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]