SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032556 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032556
Domain Number 1 Region: 69-145
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 6.12e-21
Family L23p 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032556   Gene: ENSMMUG00000029188   Transcript: ENSMMUT00000039469
Sequence length 152
Comment pep:novel chromosome:MMUL_1:7:165955736:165956209:-1 gene:ENSMMUG00000029188 transcript:ENSMMUT00000039469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKAKKEAPAPPKAKAKAKAKALKAKKAVLKGIHSHTSRTFQQPKTLQLQGQPKYPQKT
APRRNKLDHYTTIKLPPTTESAMKKRDDNNTPVFTVDVKANKRQIKQAVKKLCDPDVAMV
NSLIQPDREKEAYVQPAPDYDAWDVANKTGII
Download sequence
Identical sequences ENSMMUP00000032556 ENSMMUP00000032556 9544.ENSMMUP00000032556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]