SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032565 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032565
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.11e-18
Family MHC antigen-recognition domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 61-131
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-17
Family C1 set domains (antibody constant domain-like) 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032565   Gene: ENSMMUG00000019258   Transcript: ENSMMUT00000039478
Sequence length 179
Comment pep:known scaffold:MMUL_1:1099214051039:1729:3124:-1 gene:ENSMMUG00000019258 transcript:ENSMMUT00000039478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFDGDEIFHVDMAKKETVWREEFGRFASFEAQGALANIAVDKANLEIMTKRSNNTPITNG
GFSPPVVKVTWLKNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDIYDCKVEHWGL
DAPLLKHWEFDAPSPLPETTENVVCALGLIVGLVGIIVGTVFIIKGVRKSNAAERRGPL
Download sequence
Identical sequences ENSMMUP00000032565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]