SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032594 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032594
Domain Number 1 Region: 4-174
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000753
Family Leucine-rich repeat variant 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032594   Gene: ENSMMUG00000029213   Transcript: ENSMMUT00000039517
Sequence length 197
Comment pep:novel chromosome:MMUL_1:20:17870617:17878689:-1 gene:ENSMMUG00000029213 transcript:ENSMMUT00000039517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPENKLVLVKQLDNILAAVHDVL
NESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKFSSSAKDEVKLLYLCATYKAL
ETVGEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCILLVARCYPHIFSTNFRVSSP
FHFSDHGVRGMVVCVRN
Download sequence
Identical sequences A0A2I3M1V9 F6QV17 G7Q0K9
ENSMMUP00000032594 ENSMMUP00000032593 9544.ENSMMUP00000032594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]