SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032734 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032734
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-62
Family ALDH-like 0.0000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032734   Gene: ENSMMUG00000012684   Transcript: ENSMMUT00000039669
Sequence length 252
Comment pep:known chromosome:MMUL_1:7:137155472:137166776:-1 gene:ENSMMUG00000012684 transcript:ENSMMUT00000039669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVERAKNL
RVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTI
ISNVKPNMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHL
VDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATL
SSPAVAMPTMGR
Download sequence
Identical sequences ENSMMUP00000032734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]