SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032792 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032792
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032792   Gene: ENSMMUG00000029299   Transcript: ENSMMUT00000039726
Sequence length 57
Comment pep:known chromosome:MMUL_1:7:133520048:133520221:1 gene:ENSMMUG00000029299 transcript:ENSMMUT00000039726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPLLAMSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences G7PAR7
ENSMMUP00000032792 9544.ENSMMUP00000032792 ENSMMUP00000032792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]