SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033111 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033111
Domain Number 1 Region: 1-440
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-150
Family ALDH-like 0.0000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033111   Gene: ENSMMUG00000029428   Transcript: ENSMMUT00000040039
Sequence length 441
Comment pep:known_by_projection chromosome:MMUL_1:4:128906978:128931939:1 gene:ENSMMUG00000029428 transcript:ENSMMUT00000040039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEAAVKAAREAFPGWSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMD
IPRSVQNFRFFASSILHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIA
PAIAAGNTVVAKPSELTSVTAWMLCTLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPL
ISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEI
CLCTSRIFVQKSIYTEFLKRFVEATRKWKVGIPSDPLASMGALISKAHLEKVRSYVKRAL
AEGAQIWCGEGVDKLNLPARSQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEE
EVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIG
REGAKDSYDFFTEIKTITVKH
Download sequence
Identical sequences ENSMMUP00000033111 ENSMMUP00000033110 9544.ENSMMUP00000033111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]