SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033120 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033120
Domain Number 1 Region: 23-103
Classification Level Classification E-value
Superfamily Immunoglobulin 2.19e-16
Family V set domains (antibody variable domain-like) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033120   Gene: ENSMMUG00000029430   Transcript: ENSMMUT00000040047
Sequence length 103
Comment pep:known_by_projection chromosome:MMUL_1:7:85118821:85119249:1 gene:ENSMMUG00000029430 transcript:ENSMMUT00000040047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFSLDFPILILMFGETGSNSVKQTGQITILEGASVTMNCTYTSAGYPTLFWYVQYPNKP
LQLLQRQTMENSKNFGVGNIKDKNSPIVKYSVQVSDSAVYCCL
Download sequence
Identical sequences ENSMMUP00000033120 ENSMMUP00000033120 9544.ENSMMUP00000033120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]