SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033331 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000033331
Domain Number - Region: 4-34
Classification Level Classification E-value
Superfamily POZ domain 0.0863
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033331   Gene: ENSMMUG00000005093   Transcript: ENSMMUT00000040264
Sequence length 176
Comment pep:known chromosome:MMUL_1:4:93002706:93051375:1 gene:ENSMMUG00000005093 transcript:ENSMMUT00000040264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFNLTLLEKAVI
DFLVKHLSELLKSRPEDVLTLPYCLLQEVLKSDRLTSLSEEQIWQKCGIYAAFCALRGNW
CPGISQWDDKTASCEVVGTQLPLPAHGRAPAIHPLWPNGCGYSPYSCPVPPPCPSK
Download sequence
Identical sequences F7GED7
ENSMMUP00000033331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]