SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033418 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033418
Domain Number 1 Region: 14-372
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-87
Family alpha-mannosidase, C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033418   Gene: ENSMMUG00000009279   Transcript: ENSMMUT00000040350
Sequence length 425
Comment pep:known_by_projection chromosome:MMUL_1:7:54259998:54263501:-1 gene:ENSMMUG00000009279 transcript:ENSMMUT00000040350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPKPGGAHSLALVTVPSMGYAPVPPPTSLQPLLPQQPVFVLQETDGSVTLDNGIIRVK
LDPTGRLTSLVLVASGREAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAG
TLAVGTEGGLRGSAWFLLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPA
RVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASV
QGSVLSLSLLRAPKAPDATADMGRHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAP
SPAPATSWSAFSLSSPAVVLETVKQARGGIPQRRSLVLRLYEAHGSHVDCWLHLSLPVQE
AILCDLLERPDPAGHLSGQPPEAHLFSLPSAVPVARASASTTLSPWGWGFVCGRFWGLLI
SVSPA
Download sequence
Identical sequences ENSMMUP00000033418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]