SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033419 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033419
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.00000000186
Family N-terminal domain of MutM-like DNA repair proteins 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033419   Gene: ENSMMUG00000013079   Transcript: ENSMMUT00000040351
Sequence length 140
Comment pep:known_by_projection chromosome:MMUL_1:7:54253075:54256311:1 gene:ENSMMUG00000013079 transcript:ENSMMUT00000040351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAHPPQEPLGAPRGAATPCPPALLYGPAWPPARPVFRGRPPVWPLGPWGQVAARPR
ALCLAGTVSLQGECATKPSG
Download sequence
Identical sequences ENSMMUP00000033419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]