SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033579 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033579
Domain Number 1 Region: 282-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-51
Family SPRY domain 0.0000413
Further Details:      
 
Domain Number 2 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-18
Family V set domains (antibody variable domain-like) 0.00019
Further Details:      
 
Domain Number 3 Region: 141-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000993
Family C1 set domains (antibody constant domain-like) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033579   Gene: ENSMMUG00000029634   Transcript: ENSMMUT00000040522
Sequence length 467
Comment pep:known_by_projection chromosome:MMUL_1:6:177658522:177675332:1 gene:ENSMMUG00000029634 transcript:ENSMMUT00000040522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVLILVLSFYKLVSGQWQVTGPGKFVQASVGEDAVFSCSLFPETSAEAMEVRFFRNQL
HAVVHLYRDEEDWEFMQMPQYRGRTKLVKDSIREGHVSLRLKNITLLDMGLYGCWFSSQI
YDEEATWELQVSALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTVKWKGPQGQHLSSDSR
ANADGHNMYDVETSIIVQENVGSISCSIHLAEQSHEVESKVLIGETFFQPSPWRLASILL
GLLCGGLCVVVMGMTVVFFKSKGNPIAAFRSLERAHDTQKELREARKHAVEVTLDPETAH
PQLCVSDLKTVTHRKGPQKVPYSTKRFTRKSVVASQGFQAGKHYWEVDVGQHVGWCVGVC
QDDTDRRKDSVTLSPNNGYWVFGLTTEYLYFTFNPHFINLSLETPPTRVGVFLDYEGGNI
SFFNTNDQSRICILTCQFQGLLRPYIQHVIYEEENRTPIFICPVSWD
Download sequence
Identical sequences ENSMMUP00000033579 ENSMMUP00000033579 9544.ENSMMUP00000033579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]