SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033743 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033743
Domain Number 1 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033743   Gene: ENSMMUG00000008993   Transcript: ENSMMUT00000040708
Sequence length 499
Comment pep:known chromosome:MMUL_1:4:39016604:39067227:-1 gene:ENSMMUG00000008993 transcript:ENSMMUT00000040708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTRRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSAASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLAPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRPPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNAEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSDESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Download sequence
Identical sequences A0A2K5VDV3 F6VWZ8
ENSMMUP00000011777 ENSMMUP00000033743 9544.ENSMMUP00000033743 ENSMMUP00000011777 XP_001117117.1.72884 XP_005553165.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]