SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033806 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033806
Domain Number 1 Region: 28-139
Classification Level Classification E-value
Superfamily FKBP-like 8.84e-30
Family FKBP immunophilin/proline isomerase 0.00000324
Further Details:      
 
Domain Number 2 Region: 140-220
Classification Level Classification E-value
Superfamily FKBP-like 0.000000000000179
Family FKBP immunophilin/proline isomerase 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033806   Gene: ENSMMUG00000011520   Transcript: ENSMMUT00000040780
Sequence length 266
Comment pep:known_by_projection chromosome:MMUL_1:4:35317172:35374358:-1 gene:ENSMMUG00000011520 transcript:ENSMMUT00000040780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMKVPRTVEKAPQPLLLSRERILPPKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS
NGKKFDSSHDRSEPFVFSLGKKDSILSKSLTVTQPRKGEICHLLCKPEYAYGSAGSLPKI
PSNATLFFEAILLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGERMFD
CRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRPKNPGRWIPKKNWSRLPLSK
RREPYTSRCVSPCTILSISNNLLKCQ
Download sequence
Identical sequences ENSMMUP00000033806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]