SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033873 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033873
Domain Number 1 Region: 551-658
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.73e-18
Family Protein kinases, catalytic subunit 0.0000151
Further Details:      
 
Domain Number 2 Region: 202-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000271
Family C1 set domains (antibody constant domain-like) 0.066
Further Details:      
 
Domain Number 3 Region: 399-495
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000516
Family I set domains 0.059
Further Details:      
 
Domain Number 4 Region: 311-406
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000974
Family I set domains 0.057
Further Details:      
 
Domain Number 5 Region: 21-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000318
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 97-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000647
Family C1 set domains (antibody constant domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033873   Gene: ENSMMUG00000011556   Transcript: ENSMMUT00000040845
Sequence length 671
Comment pep:known_by_projection chromosome:MMUL_1:6:146531956:146565836:-1 gene:ENSMMUG00000011556 transcript:ENSMMUT00000040845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVLLLLLVVTAWHGQGIPVIEPSGPELVVKPGEMVTLRCVGNGSVEWDGPISPHWTL
YSDGPSSVLTTTNATFQNTRTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAKEVVVFED
QDALLPCLLTDPVLEAGVSLVRLRGRPLLRHTNYSFSPWHGFTIHRAKFIQGQDYQCSAL
MGSRKVMSISIRLKVQKVIPGPPALTLVPEELVRIRGEAAQIVCSASNIDVDFDVFLQHN
TTKLAIPQRSDFHDNRYQKVLTLSLGQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LDLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTSINGSGTLLCA
ASGYPQPNVTWLQCAGHTDRCDEAQVLQVWVDPHPEVLSQEPFQKVTVQSLLTAETLEHN
QTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSVMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGTVA
SPARVWTPMWR
Download sequence
Identical sequences ENSMMUP00000033873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]