SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033926 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033926
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Immunoglobulin 3.26e-17
Family C1 set domains (antibody constant domain-like) 0.00000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033926   Gene: ENSMMUG00000005534   Transcript: ENSMMUT00000040897
Sequence length 166
Comment pep:known chromosome:MMUL_1:4:32656336:32660166:-1 gene:ENSMMUG00000005534 transcript:ENSMMUT00000040897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHEQNQGAALLQMLPLLWLLPHSWAVPEGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPP
MLTVNWQHHSVPVEGSGPTFVSAVDGLSFQAFSYLNITPEPSDVFSCIVTHEIDRYTAIA
YWVPQNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGG
Download sequence
Identical sequences ENSMMUP00000033926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]