SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033942 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033942
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.34e-28
Family MHC antigen-recognition domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 112-206
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-23
Family C1 set domains (antibody constant domain-like) 0.00000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033942   Gene: ENSMMUG00000020158   Transcript: ENSMMUT00000040912
Sequence length 254
Comment pep:known chromosome:MMUL_1:4:32373490:32379742:1 gene:ENSMMUG00000020158 transcript:ENSMMUT00000040912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILNKALMLGALALTTVMSSCGGEDIVADHLASYGVNFYQSYGLSGQYSHEFDGDEQFYV
DLGRKETVWRLPIPYRYGFDPQFALRNIAVLTHNLNVLIKRSNSTAATNEVPEVTVFSKS
PVTLGHPNTLICLVDHIFPPVVNITWLSNGRSVTEGVSETSFLSKSDHSFFKISYLTFLP
SADEIYDCRVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSAGLVGIVVGTILIIR
GLRSVGASRHQGPL
Download sequence
Identical sequences B5M475 F8K937
NP_001181609.1.72884 XP_014991547.1.72884 ENSMMUP00000019166 ENSMMUP00000033942 ENSMMUP00000033943 9544.ENSMMUP00000033942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]