SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033950 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033950
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.58e-35
Family MHC antigen-recognition domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 131-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-26
Family C1 set domains (antibody constant domain-like) 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033950   Gene: ENSMMUG00000029799   Transcript: ENSMMUT00000040920
Sequence length 268
Comment pep:known chromosome:MMUL_1:4:32310083:32322411:-1 gene:ENSMMUG00000029799 transcript:ENSMMUT00000040920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLKLHGGSCMAALTVTLMVLSSPLALAGDTQSRFLEQVKFECHFFNGTERVRYLERRV
HNQEEYARFDSDVGEYRAVTELGRPDAEYWNGQKDLLERRRAEVPTKQRDLLCLPDSFSL
PFFLLVQPKVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQ
NGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLG
LLFLGAGLFIYFRNQKGHSGLQPTGNTF
Download sequence
Identical sequences ENSMMUP00000033950 9544.ENSMMUP00000033950 ENSMMUP00000013914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]