SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034033 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034033
Domain Number 1 Region: 230-518
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-53
Family Eukaryotic proteases 0.0000275
Further Details:      
 
Domain Number 2 Region: 52-228
Classification Level Classification E-value
Superfamily vWA-like 4.9e-27
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 14-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000931
Family Complement control module/SCR domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034033   Gene: ENSMMUG00000000729   Transcript: ENSMMUT00000041002
Sequence length 525
Comment pep:known chromosome:MMUL_1:4:31579976:31601651:1 gene:ENSMMUG00000000729 transcript:ENSMMUT00000041002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLFCLLFLYPAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSNLVLTGSAERECQGNGV
WSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQRTKDHENGTGTNTYAALNSVY
LMMNNQMQLLGMKTMAWQEIRHAIILLTDGKSNMGGSPKTAVDQIREILNINQKRNDYLD
IYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGN
MSANASDQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKS
QWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTME
ANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKT
MFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLG
SADKNSRKRAPRSKVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences ENSMMUP00000034033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]