SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034223 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034223
Domain Number 1 Region: 116-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.38e-72
Family Extended AAA-ATPase domain 0.00000164
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034223
Domain Number - Region: 17-46
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000811
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034223   Gene: ENSMMUG00000016769   Transcript: ENSMMUT00000041187
Sequence length 383
Comment pep:known_by_projection chromosome:MMUL_1:16:59340974:59345578:1 gene:ENSMMUG00000016769 transcript:ENSMMUT00000041187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVSCLPQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKK
KVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKV
PDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAV
AHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGS
GGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEE
ARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDF
EMAVAKVMQKDSEKNMSIKKLWK
Download sequence
Identical sequences ENSMMUP00000022044 ENSMMUP00000034223 9544.ENSMMUP00000034223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]