SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034244 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034244
Domain Number 1 Region: 163-569
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.08e-88
Family L-arabinose binding protein-like 0.00051
Further Details:      
 
Domain Number 2 Region: 95-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000025
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034244
Domain Number - Region: 67-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00667
Family Complement control module/SCR domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034244   Gene: ENSMMUG00000021483   Transcript: ENSMMUT00000041209
Sequence length 954
Comment pep:known chromosome:MMUL_1:4:29336275:29369271:-1 gene:ENSMMUG00000021483 transcript:ENSMMUT00000041209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLAPLFLRPPGAGGAQTPNATSECILLRRPRALLRPTSLSLHLLISGPHHDPVT
RGSVPVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARV
DFRCDPDFHLVGSSRSICSQGQWSTPKPHCQGRLCEDGKRRAVYIGALFPMSGGWPGGQA
CQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCS
SVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWK
KIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFY
ETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEI
VMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGG
GGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSY
KKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAV
VCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARL
WLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAI
WQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFL
AYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYI
TLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEE
RVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPPEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences 9544.ENSMMUP00000034244 ENSMMUP00000034244 ENSMMUP00000028300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]