SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034318 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034318
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-37
Family Nucleosome core histones 0.0000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034318   Gene: ENSMMUG00000029919   Transcript: ENSMMUT00000041284
Sequence length 69
Comment pep:known chromosome:MMUL_1:4:26192966:26193387:1 gene:ENSMMUG00000029919 transcript:ENSMMUT00000041284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSNVF
Download sequence
Identical sequences ENSMMUP00000034318 ENSMMUP00000034318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]