SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034467 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034467
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 9.29e-21
Family Ribosomal protein L39e 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034467   Gene: ENSMMUG00000029998   Transcript: ENSMMUT00000041436
Sequence length 57
Comment pep:novel chromosome:MMUL_1:6:71779072:71779245:-1 gene:ENSMMUG00000029998 transcript:ENSMMUT00000041436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPLLAMSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWGRTKLGL
Download sequence
Identical sequences ENSMMUP00000034467 ENSMMUP00000034467 9544.ENSMMUP00000034467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]